SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603050|ref|NP_246122.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603050|ref|NP_246122.1|
Domain Number 1 Region: 190-329
Classification Level Classification E-value
Superfamily CBS-domain pair 9.85e-23
Family CBS-domain pair 0.0051
Further Details:      
 
Domain Number 2 Region: 340-418
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.58e-21
Family CorC/HlyC domain-like 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603050|ref|NP_246122.1|
Sequence length 419
Comment hypothetical protein PM1185 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MDSIPLSTLFITLIILLIISAYFSGSETGLLSANRYRLRHLAEKGHRGAKKAEKLLKKTD
VLLSLILICNNLVNITASAITTIIGMRLYGDAGVAIATGALTFVMLIFAEILPKTIAARY
PEKVAFTSSHLLSVFLRLFTPLVYLMNLIIQGILALLRLKSDNKSTSLSPEELRSIVNES
GKFIPSAHQEMLLSILDLEGVTVDDIMVPRNDIGGIDIDDDWKAIMRQLNHAAHGRVVLY
KGNMDENILGMLRVREAYRLMLDKNEFNKETLIRAADEVYFIPEGTPLNSQLLNFRNNKE
RIGLVVDEYGDIKGLVTLEDILEEIVGEFTTSTAPSINDEVIPQSDGSLIIEGSANLRDL
NKLFDWNLDTEDARTFNGLILEHLEEIPEEGTVCEINGLQITILEVNDNMIKQAKVIKL
Download sequence
Identical sequences A0A1D7R431 A0A2K2YKN6 Q9CLN4 V4NFN7
gi|386835814|ref|YP_006241134.1| gi|15603050|ref|NP_246122.1| gi|378775771|ref|YP_005178014.1| WP_005717561.1.10027 WP_005717561.1.10721 WP_005717561.1.11014 WP_005717561.1.11214 WP_005717561.1.11947 WP_005717561.1.12156 WP_005717561.1.1307 WP_005717561.1.14908 WP_005717561.1.17217 WP_005717561.1.17980 WP_005717561.1.18123 WP_005717561.1.19996 WP_005717561.1.20287 WP_005717561.1.21657 WP_005717561.1.22153 WP_005717561.1.2313 WP_005717561.1.23830 WP_005717561.1.24757 WP_005717561.1.26616 WP_005717561.1.27416 WP_005717561.1.27592 WP_005717561.1.27664 WP_005717561.1.28084 WP_005717561.1.29697 WP_005717561.1.30617 WP_005717561.1.34253 WP_005717561.1.35562 WP_005717561.1.35978 WP_005717561.1.36022 WP_005717561.1.3807 WP_005717561.1.38246 WP_005717561.1.3839 WP_005717561.1.39152 WP_005717561.1.3957 WP_005717561.1.40210 WP_005717561.1.40787 WP_005717561.1.41351 WP_005717561.1.41462 WP_005717561.1.41657 WP_005717561.1.41667 WP_005717561.1.4211 WP_005717561.1.42469 WP_005717561.1.42512 WP_005717561.1.42943 WP_005717561.1.43687 WP_005717561.1.44741 WP_005717561.1.45422 WP_005717561.1.47685 WP_005717561.1.4808 WP_005717561.1.49053 WP_005717561.1.51342 WP_005717561.1.52066 WP_005717561.1.52585 WP_005717561.1.52859 WP_005717561.1.53852 WP_005717561.1.55074 WP_005717561.1.55401 WP_005717561.1.57420 WP_005717561.1.58111 WP_005717561.1.58257 WP_005717561.1.58450 WP_005717561.1.58910 WP_005717561.1.59455 WP_005717561.1.60664 WP_005717561.1.61098 WP_005717561.1.61860 WP_005717561.1.62016 WP_005717561.1.6219 WP_005717561.1.6332 WP_005717561.1.63549 WP_005717561.1.65482 WP_005717561.1.65878 WP_005717561.1.66934 WP_005717561.1.66990 WP_005717561.1.72215 WP_005717561.1.73917 WP_005717561.1.74955 WP_005717561.1.75804 WP_005717561.1.78987 WP_005717561.1.79347 WP_005717561.1.79593 WP_005717561.1.80223 WP_005717561.1.80589 WP_005717561.1.80911 WP_005717561.1.81885 WP_005717561.1.8281 WP_005717561.1.87897 WP_005717561.1.88402 WP_005717561.1.89773 WP_005717561.1.90081 WP_005717561.1.90179 WP_005717561.1.90578 WP_005717561.1.91495 WP_005717561.1.92478 WP_005717561.1.93940 WP_005717561.1.94432 WP_005717561.1.94435 WP_005717561.1.95718 WP_005717561.1.9746 WP_005717561.1.9947 272843.PM1185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]