SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77456440|ref|YP_345945.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77456440|ref|YP_345945.1|
Domain Number 1 Region: 96-301
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.99e-29
Family Phosphate binding protein-like 0.0045
Further Details:      
 
Domain Number 2 Region: 4-79
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.58e-21
Family LysR-like transcriptional regulators 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77456440|ref|YP_345945.1|
Sequence length 311
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MPEKHMDLRQLRYFIALNEHRSFVRAADAMGITQPAFSRSIQGLEQEFGCVLVDRGNKDL
RPTPEGQVVLQHALTLVQGAALLSAEVTQMTKLDAGELHFGCGPAPAVKLVPDAVAQFIN
AHPKVRTCFQVDNWEKLSRALSREEIEFFIADIRHFESDPNFQTQPLTPKRGVFFCRPGH
PLLAKESLSTNDMFDYPLATTLIPPGIRKLLANLSGRIDFSPTIETEHFPALVKVVLQSN
AIGVGTEEAFVEDIAQGSLALLHWRNLPQNLESMNARCGIVSRTGFRLSPAARAMIETLV
AVDKQAISVAV
Download sequence
Identical sequences A0A173IUS2 Q3KJV0
205922.Pfl01_0212 gi|77456440|ref|YP_345945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]