SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77456465|ref|YP_345970.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77456465|ref|YP_345970.1|
Domain Number 1 Region: 31-267
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.68e-64
Family Phosphate binding protein-like 0.0000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77456465|ref|YP_345970.1|
Sequence length 269
Comment NLPA lipoprotein [Pseudomonas fluorescens Pf0-1]
Sequence
MTKKLLSHPVKALALAFGLFSSAVFAADAPLKIGTTAAFAIPLEAAVEEASKQGLKVELV
EFTDWIAPNVSLAAGDIDVNYFQHIPFLENAKAASGFDLVPFAPGIINNVGLYSKKYKSF
DELPEGASVAIANDPINSGRGLQLLAKAGLITLKPGVGYKATEDDIVANPKKIKILQVEA
VQLVRAYDDADLVQGYPAYIRLAKTFDAGSALLFDGLDHKEYVIQFVIQPKSKTDPRLIK
FVDIYQHSPAVRAALDKAHGKLYQAGWES
Download sequence
Identical sequences A0A0C1WRQ5 A0A1G5NAH0 A0A1G6CDJ2 A0A2K4HUC1 J3FC83 Q3KJS5
WP_007952748.1.1491 WP_007952748.1.20937 WP_007952748.1.21389 WP_007952748.1.21564 WP_007952748.1.22023 WP_007952748.1.2668 WP_007952748.1.30523 WP_007952748.1.31280 WP_007952748.1.32803 WP_007952748.1.38776 WP_007952748.1.39127 WP_007952748.1.46342 WP_007952748.1.46399 WP_007952748.1.47897 WP_007952748.1.51676 WP_007952748.1.54387 WP_007952748.1.55686 WP_007952748.1.55771 WP_007952748.1.58385 WP_007952748.1.62013 WP_007952748.1.64081 WP_007952748.1.6588 WP_007952748.1.66386 WP_007952748.1.72974 WP_007952748.1.75567 WP_007952748.1.77688 WP_007952748.1.84829 WP_007952748.1.91175 WP_007952748.1.91687 WP_007952748.1.91867 WP_007952748.1.98588 WP_007952748.1.9994 gi|77456465|ref|YP_345970.1| 205922.Pfl01_0237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]