SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77456484|ref|YP_345989.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77456484|ref|YP_345989.1|
Domain Number 1 Region: 27-246
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.46e-45
Family Phosphate binding protein-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77456484|ref|YP_345989.1|
Sequence length 325
Comment taurine ABC transporter, periplasmic binding protein [Pseudomonas fluorescens Pf0-1]
Sequence
MKLNFPLRLLAVASLAAASFLAQAADLTVAYQTTVDPAKVAQADGAYEKATKADINWRKF
DNGADIIAAIASGDVQIGYLGSSPLTAAITRKVPVETFLIATQIGAAEALVARDGSGIKT
PQDLVGKKIAVPFVSTGHYSLLAALKHWNIDPSKVTVLNLAPPAIIAAWKRGDIDATYVW
DPALGVAKENGKVLITSGELAKFGAPTFDAWIVRKDFAEKHPEIVTAFAKVTLDAYADYR
KDPKAWLANQSNVDKLVKLSGAKASDIPLLLQGNVYPLAADQVSDLGAPTTKAITDTATF
LKEQGKVEAVLPDYAPYVSAKYITN
Download sequence
Identical sequences Q3KJQ6
WP_011331960.1.2668 gi|77456484|ref|YP_345989.1| 205922.Pfl01_0256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]