SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77456527|ref|YP_346032.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77456527|ref|YP_346032.1|
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.86e-17
Family LysR-like transcriptional regulators 0.016
Further Details:      
 
Domain Number 2 Region: 90-255
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000525
Family Phosphate binding protein-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77456527|ref|YP_346032.1|
Sequence length 308
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MDSRTLRNLMRIVQTGSLSAAAEHSCLTVQALAAQLNKVEEQFGFRLFRRSNKGLTLTPQ
GTELTPYMDRVLIATRQMEEKVEALKVPGQRTLKVALNTTLAPDFNRRLIGRLIEVFPDY
QMEFSYAESMENLSKLKNEDFDLAVLIGPQRPGLPSIVLPEVQVQVVGAHCGQENDPLTL
LGNKFQVRPAEDCPYSHSFLRFLDAGLGNHENSQRTIYSCSETLTLSLITQMDAVGMVSR
EAAQKNGLTIFPGFEDFLEVRLAVNNPDLSGQALNDVVDLPLHERAERNVRSRPNRHTEK
EVFAEIRT
Download sequence
Identical sequences Q3KJL3
WP_011331998.1.2668 WP_011331998.1.30523 WP_011331998.1.54387 WP_011331998.1.62013 WP_011331998.1.72974 WP_011331998.1.84829 WP_011331998.1.91867 205922.Pfl01_0299 gi|77456527|ref|YP_346032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]