SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77456943|ref|YP_346448.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77456943|ref|YP_346448.1|
Domain Number 1 Region: 90-290
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.21e-38
Family Phosphate binding protein-like 0.0019
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.36e-22
Family LysR-like transcriptional regulators 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77456943|ref|YP_346448.1|
Sequence length 293
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MHFDLTDLRLYLHILDSGNITAGAARSHLSLAAASARIRTMEASLGTEFLERGRRGVTPT
PAGKALAQHARVLLQQAERLQQDLAEYARGVKGQVRLLCNTTALSEYLPEVLADFLREHP
NLDIDLQELPSTRITHALRQGAADLGIVSDAIDTTDLQTRAFRDDPLMLILPLDHPLSDA
TEVSFSDALRHDFVGLDADSALAVYLEEQALHSGSRMQIRIRADGFNGVMRMVARGAGLG
IVPLAAVQRAAPQAFKTLPMNEGWARRKLLLCARDFAALPAYARALLDALTLP
Download sequence
Identical sequences Q3KIE7
205922.Pfl01_0715 gi|77456943|ref|YP_346448.1| WP_011332351.1.2668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]