SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77457043|ref|YP_346548.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77457043|ref|YP_346548.1|
Domain Number 1 Region: 27-529
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.41e-145
Family Phosphate binding protein-like 0.0000000000702
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77457043|ref|YP_346548.1|
Sequence length 533
Comment extracellular solute-binding protein [Pseudomonas fluorescens Pf0-1]
Sequence
MDRFTLKPLLITLTLTAITPIANAATTLVYCSEASPAGFDPSQYTSGTDFDASAETVFNR
LTQFKRGGTEVEPGLATKWDVSPDGLQYTFHLRQNVKFHTTDYFTPTRTFNADDVLFTFQ
RLLDPENAFRKAYPAESPYFTDMGLNTTIKSVEKLDDNTVRFNLNNVDAAFVQNLAMSFA
SVQSAEYAAQLLKEGHAADLNQKPVGTGPFVFKRYQKDAQIRYAANKDYWKPEDVKLDNL
VFSITPDAAVRLQKLKTGECQVSGYPRPADIEVMEKDPNLRVLKQPGFNLGFLAYNTTHP
PLDQLKVRQALDMAIDKPAIIKAVYQSAGQLAQNALPPAQWSFDPNIKDAPHDPVKAKAL
LKEARVAPGTTINLWAMTVQRASNPNARMSAQMIQQDWEKIGIKANIVSYEWGEYIKRAK
NGEHDAMIYGWTGDNGDPDNWLGVLYSCAAVKGSNYAKWCDPAYDKLVQQAKVSTDKSQR
VKLYQQAQLILKQQVPITPIANSTVFQPLRKEVTDFKISPFGLTPFYGVGINK
Download sequence
Identical sequences Q3KI47
WP_011332438.1.2668 205922.Pfl01_0816 gi|77457043|ref|YP_346548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]