SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77457097|ref|YP_346602.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77457097|ref|YP_346602.1|
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.69e-64
Family Phosphate binding protein-like 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77457097|ref|YP_346602.1|
Sequence length 211
Comment ATP phosphoribosyltransferase [Pseudomonas fluorescens Pf0-1]
Sequence
MLTIALSKGRILDDTLPLLAEAGIVPTENPDKSRKLIIPTTQEDVRLLIVRATDVPTYVE
HGAADLGVAGKDVLMEYTGQGLYEPLDLQIAQCKLMTAGKVGAVEPKGRLRVATKFVNVA
KRYYAEQGRQVDIIKLYGSMELAPLIGLADKIIDVVDTGNTLRANGLEPQELIATISSRL
VVNKASMKMQHARIQALIDTLRKAVESRHRG
Download sequence
Identical sequences A0A173IWF6 A0A1G5MIA6 A0A1G6F1F5 A0A2K4HTE4 J3FAL0 Q3KHZ3
gi|77457097|ref|YP_346602.1| WP_007953554.1.1491 WP_007953554.1.15864 WP_007953554.1.20937 WP_007953554.1.21389 WP_007953554.1.21564 WP_007953554.1.22023 WP_007953554.1.2668 WP_007953554.1.30523 WP_007953554.1.31280 WP_007953554.1.38776 WP_007953554.1.39127 WP_007953554.1.46058 WP_007953554.1.46342 WP_007953554.1.46399 WP_007953554.1.47299 WP_007953554.1.47897 WP_007953554.1.51676 WP_007953554.1.53106 WP_007953554.1.54387 WP_007953554.1.54700 WP_007953554.1.55575 WP_007953554.1.55686 WP_007953554.1.55771 WP_007953554.1.55954 WP_007953554.1.58385 WP_007953554.1.58965 WP_007953554.1.62013 WP_007953554.1.64081 WP_007953554.1.6588 WP_007953554.1.66221 WP_007953554.1.66386 WP_007953554.1.72974 WP_007953554.1.75567 WP_007953554.1.77688 WP_007953554.1.84829 WP_007953554.1.8936 WP_007953554.1.91175 WP_007953554.1.91867 WP_007953554.1.96080 WP_007953554.1.98588 WP_007953554.1.9994 205922.Pfl01_0870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]