SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77457200|ref|YP_346705.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77457200|ref|YP_346705.1|
Domain Number 1 Region: 28-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.54e-45
Family Phosphate binding protein-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77457200|ref|YP_346705.1|
Sequence length 343
Comment extracellular solute-binding protein [Pseudomonas fluorescens Pf0-1]
Sequence
MKMLKSTLAIVTAAAVLGVSGFAQAGATLDAVKKKGFVQCGVSDGLPGFSVPDSTGKIVG
IDADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTMTSSRDAGMGLKF
PGFITYYDGIGFLVNNKLGVKSAKELDGATICIQAGTTTELNVSDYFRGNGLKYTPITFD
TSDESAKSLESGRCDVLTSDKSQLFAQRSKLASPKDYVVLPETISKEPLGPVVRNGDDEW
LAIVRWVGYALLNTEEAGISSKNVEAEAKSTKNPDVARMLGADGEYGKDLKLPKDWVVQI
VKQVGNYGEIFEKNLGKSTPLEIDRGLNALWNNGGIQYAPPVR
Download sequence
Identical sequences A0A0C1ZQA0 Q3KHP0
gi|77457200|ref|YP_346705.1| WP_011332571.1.22023 WP_011332571.1.2668 WP_011332571.1.46399 WP_011332571.1.47897 WP_011332571.1.91687 205922.Pfl01_0973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]