SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77457277|ref|YP_346782.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77457277|ref|YP_346782.1|
Domain Number 1 Region: 87-295
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.57e-37
Family Phosphate binding protein-like 0.00059
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.82e-25
Family LysR-like transcriptional regulators 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77457277|ref|YP_346782.1|
Sequence length 304
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MMTLRQIRHFIAVAETGSISAAAQTAFISQSTLTLAIQQLEEEIGVSLFNRHAKGMTLTH
QGHQFLRQAHLILATVDNAKRSLQQSTDQVAGQLIVGVTSLVAGYYLADLLTRFQRAYPN
VEIRVMEDERPYIEHLLVSGEIDVGVLILSNLEDRHALQTEVLTHSPHRLWLPAQHPLLE
HDSINLADVAREPLIQLNVDEMDRNAQRLWRGAGLQPKITLRTASTEAVRSLVAAGLGVS
IQPDMTYRPWSLEGDIIEARPIADLNQTLDVGLAWRRGTARPALVDPFLTVAREQPHGGR
KPSI
Download sequence
Identical sequences A0A0C1WTX3 A0A0C2RYT5 A0A173IWT8 A0A1G5MG22 A0A1G6EQ82 A0A2A2PJ70 A0A2K4HJS1 J2XGR3 Q3KHG3
205922.Pfl01_1050 gi|77457277|ref|YP_346782.1| WP_007954670.1.1485 WP_007954670.1.1491 WP_007954670.1.15864 WP_007954670.1.20937 WP_007954670.1.21564 WP_007954670.1.22023 WP_007954670.1.2668 WP_007954670.1.30523 WP_007954670.1.31280 WP_007954670.1.32531 WP_007954670.1.32803 WP_007954670.1.38776 WP_007954670.1.39127 WP_007954670.1.46342 WP_007954670.1.46399 WP_007954670.1.47897 WP_007954670.1.51676 WP_007954670.1.52869 WP_007954670.1.53106 WP_007954670.1.54387 WP_007954670.1.54700 WP_007954670.1.55686 WP_007954670.1.55771 WP_007954670.1.58385 WP_007954670.1.58965 WP_007954670.1.62013 WP_007954670.1.64081 WP_007954670.1.6588 WP_007954670.1.66386 WP_007954670.1.72974 WP_007954670.1.75567 WP_007954670.1.77688 WP_007954670.1.84829 WP_007954670.1.86311 WP_007954670.1.91175 WP_007954670.1.91687 WP_007954670.1.91867 WP_007954670.1.96080 WP_007954670.1.98588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]