SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77457437|ref|YP_346942.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77457437|ref|YP_346942.1|
Domain Number 1 Region: 1-253
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.78e-63
Family Phosphate binding protein-like 0.000000987
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77457437|ref|YP_346942.1|
Sequence length 260
Comment extracellular solute-binding protein [Pseudomonas fluorescens Pf0-1]
Sequence
MKKALLTLSALALCMAAGSALAKEYKELRFGVDPSYAPFESKAADGSLVGFDIDLGNAIC
AELKVKCKWVESDFDGMIPGLKANKFDGVISSMTVTEAREKVIDFSSELFSGPTAYVSKK
GSGITDDVASLKGKTVGYEQGTIQEAYAKAVLDKAGVKTQAYQNQDQVYSDLTSGRLDAG
IQDMLQAELGFLKSPQGADYEVSKPVDNHLLPAKTAVGIKKGNTELKALLDKGIKALHDD
GKYAEIQKKHFGDLNLYSGK
Download sequence
Identical sequences A0A0C1ZWL1 A0A1G5MEI1 A0A1G6ESS9 A0A2K4HHM8 Q3KH03
gi|77457437|ref|YP_346942.1| 205922.Pfl01_1210 WP_011332769.1.20937 WP_011332769.1.22023 WP_011332769.1.2668 WP_011332769.1.30523 WP_011332769.1.32803 WP_011332769.1.38776 WP_011332769.1.46399 WP_011332769.1.47897 WP_011332769.1.51676 WP_011332769.1.54387 WP_011332769.1.55771 WP_011332769.1.58385 WP_011332769.1.62013 WP_011332769.1.64081 WP_011332769.1.6588 WP_011332769.1.72974 WP_011332769.1.75567 WP_011332769.1.84829 WP_011332769.1.91175 WP_011332769.1.91687 WP_011332769.1.91867 WP_011332769.1.98588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]