SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77457580|ref|YP_347085.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77457580|ref|YP_347085.1|
Domain Number 1 Region: 39-229
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000000013
Family Phosphate binding protein-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77457580|ref|YP_347085.1|
Sequence length 325
Comment hypothetical protein Pfl01_1353 [Pseudomonas fluorescens Pf0-1]
Sequence
MNRSLRRFALAAGCVLFAGQLMAEPKRPECIAPASPGGGFDLTCKLAQSALVNEKLLTKP
MRVTYMPGGVGAVAYNAVVAQRPADAGTLVAWSSGSLLNLAQGKFGRFDETNVRWLAAVG
TSYGAIAVKSDSPYKTLDDLVQALKKDPSSVVIGSGGTVGSQDWMQTALIAKAAGINPRD
LRYVALEGGGEIATALLGGHIQVGSTDISDSMPHIQSGDMRLLAVFAEKRLDEPEMKDIP
TAREQGYDIVWPVVRGFYLGPKVSDEDYAWWKDSFDKLLASEDFAKLRDQRELFPFAMTG
PELDTYVKKQVADYKVLAKEFGLIQ
Download sequence
Identical sequences Q3KGL0
gi|77457580|ref|YP_347085.1| 205922.Pfl01_1353 WP_011332896.1.22023 WP_011332896.1.2668 WP_011332896.1.30523 WP_011332896.1.46399 WP_011332896.1.47897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]