SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77457657|ref|YP_347162.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77457657|ref|YP_347162.1|
Domain Number 1 Region: 93-291
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.96e-29
Family Phosphate binding protein-like 0.0061
Further Details:      
 
Domain Number 2 Region: 5-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.98e-19
Family LysR-like transcriptional regulators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77457657|ref|YP_347162.1|
Sequence length 307
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MKAPRVTLDQWRTLQAVVDHGGFAQAAEALHRSQSSVSYTVARMQDQLGVPLLRIDGRKA
VLTEAGGVLLRRSRQLVKQASQLEDLAHHMEQGWEAEVRLVVDAAYPSARIVRALTAFMP
QSRGCRVRLREEVLSGVEEVLLEGVADLAITGLSIPGYLGAELSDVEFVAVAHPDHALHR
LNRELSFQDLETQMQVVIRDSGRQQPRDVGWLGAEQRWTVGSLATAATFVSSGLGFAWLP
RHMIERELKDGSLKLLPLDRGGNRNSSFYLYSNKDKPLGPATQILIELLRTFDTLPLDAP
FAAPEQA
Download sequence
Identical sequences A0A0C1ZRB6 A0A173IXZ9 A0A1G5MCI4 A0A1G6EKQ8 A0A2K4HU59 Q3KGD3
gi|77457657|ref|YP_347162.1| WP_011332960.1.20937 WP_011332960.1.21389 WP_011332960.1.22023 WP_011332960.1.2668 WP_011332960.1.30523 WP_011332960.1.32803 WP_011332960.1.38776 WP_011332960.1.46399 WP_011332960.1.47897 WP_011332960.1.51676 WP_011332960.1.54387 WP_011332960.1.54700 WP_011332960.1.55771 WP_011332960.1.58385 WP_011332960.1.62013 WP_011332960.1.64081 WP_011332960.1.6588 WP_011332960.1.72974 WP_011332960.1.75567 WP_011332960.1.84829 WP_011332960.1.91175 WP_011332960.1.91687 WP_011332960.1.91867 WP_011332960.1.98588 WP_011332960.1.9994 205922.Pfl01_1430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]