SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77457677|ref|YP_347182.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77457677|ref|YP_347182.1|
Domain Number 1 Region: 86-278
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.97e-38
Family Phosphate binding protein-like 0.0012
Further Details:      
 
Domain Number 2 Region: 1-109
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.03e-22
Family LysR-like transcriptional regulators 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77457677|ref|YP_347182.1|
Sequence length 297
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MEFSQLRIFQAVAEEGSITRAAERLHRVPSNLSTRLKQLEEQLGVELFVRERQRLQLSPA
GKVLLDYTGKLFALRDQASAAVMGGQPAGDFVLGTLYSTAAIHLPALLARYHKQYPAVNL
QVQSGPSGELLEGLLTGRLDAALVDGPPQLAGIDGVPLCNERLVLISEADHPPIRSARDV
EGRAVFTFRHGCAYRARLEAWFAHYQAAMGRAMEIESYQGMLACVIAGSGVALMSESMLA
SLPGRESVAVHPLAEPFASATTWLMWRRGMVGANLNAWIEQQQALYPVAGEDVRETA
Download sequence
Identical sequences J2XD15 Q3KGB3
WP_007956575.1.15864 WP_007956575.1.21389 WP_007956575.1.21564 WP_007956575.1.2668 WP_007956575.1.32803 WP_007956575.1.53106 WP_007956575.1.58965 WP_007956575.1.96080 WP_007956575.1.9994 gi|77457677|ref|YP_347182.1| 205922.Pfl01_1450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]