SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77457685|ref|YP_347190.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77457685|ref|YP_347190.1|
Domain Number 1 Region: 93-296
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.21e-37
Family Phosphate binding protein-like 0.0038
Further Details:      
 
Domain Number 2 Region: 7-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.19e-17
Family LysR-like transcriptional regulators 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77457685|ref|YP_347190.1|
Sequence length 297
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MANALPDLKLLRIFVSVVRHQGFANAQQELNLSTSAISTYMSQLEAALGLVLCHRGRGGF
SLTSKGELFHQETLRLLAELEGFEQYAAALKGELRGTLNLGVIDSTVSDKALPFAEAIGA
YSQEHPAVHLHLSVMSPYELQLGVQDNRLDLAIGAFSTRMSGLVYMPLYREQHWLYCSSR
HPLFNERRIPEQVITQQRMVGRGYWSQAELARHGFKHSAATVESMEAQLILVLSGAYIGY
LPEHYAQAWADKGDLRVLLPATFGYQAPFSMIMRRGRSREPLIQTFRDLLKAQLNQA
Download sequence
Identical sequences A0A031G6V3 A0A0C1WEL5 A0A0N1D3V4 A0A142N6G6 A0A1H8UF20 A0A285HZ23 A0A2A2PI08 A0A2C5VWF0 A0A2G6V0Y6 A0A2K4GGF4 A0A2K4I283 A0A2K4IB46 J2P8F7 J2WT86 Q3KGA5 V8R9X4 W6VQD8
fid|94012923|locus|VBIPseFlu147482_1443| gi|77457685|ref|YP_347190.1| 205922.Pfl01_1458 WP_007956593.1.14730 WP_007956593.1.1485 WP_007956593.1.1491 WP_007956593.1.15864 WP_007956593.1.17521 WP_007956593.1.21564 WP_007956593.1.24892 WP_007956593.1.25625 WP_007956593.1.26239 WP_007956593.1.2668 WP_007956593.1.30946 WP_007956593.1.31280 WP_007956593.1.32531 WP_007956593.1.32813 WP_007956593.1.36605 WP_007956593.1.39127 WP_007956593.1.46058 WP_007956593.1.46342 WP_007956593.1.46469 WP_007956593.1.47299 WP_007956593.1.51654 WP_007956593.1.52870 WP_007956593.1.53106 WP_007956593.1.55575 WP_007956593.1.55686 WP_007956593.1.55954 WP_007956593.1.58129 WP_007956593.1.58965 WP_007956593.1.66221 WP_007956593.1.66386 WP_007956593.1.73001 WP_007956593.1.76526 WP_007956593.1.77688 WP_007956593.1.77756 WP_007956593.1.85257 WP_007956593.1.86311 WP_007956593.1.8936 WP_007956593.1.94451 WP_007956593.1.95481 WP_007956593.1.96080 WP_007956593.1.99462 WP_007956593.1.9973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]