SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77458031|ref|YP_347536.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77458031|ref|YP_347536.1|
Domain Number 1 Region: 22-244
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.15e-24
Family Phosphate binding protein-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77458031|ref|YP_347536.1|
Sequence length 249
Comment hypothetical protein Pfl01_1804 [Pseudomonas fluorescens Pf0-1]
Sequence
MRWAVGAILGISLSAMASQPPLRFVIADSWAMPMVQIERGRPTQGILYDMMLSLATQVGI
PAQFHVLPRARVQNAMEHGEVDVRCYAAQSWLPNQSGDYIWSIPLLFQRDLLISRQDQPP
SADPAHLPRQSIGTVLGYSYPTLQPIFDADRLWREDARNQEQVLDKLLAGRYRYAVSNQW
ALDWFNQRLLPGQQLQAVAVLQEQKVGCYVRNDPNVPVQRILRTLLRMKMSGEIDDIIRL
YTGKSGGEP
Download sequence
Identical sequences Q3KFA9
WP_011333275.1.2668 205922.Pfl01_1804 gi|77458031|ref|YP_347536.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]