SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77458091|ref|YP_347596.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77458091|ref|YP_347596.1|
Domain Number 1 Region: 291-518
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.02e-43
Family Phosphate binding protein-like 0.0041
Further Details:      
 
Domain Number 2 Region: 637-807
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.95e-42
Family Histidine kinase 0.0023
Further Details:      
 
Domain Number 3 Region: 48-262
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.47e-32
Family Phosphate binding protein-like 0.0041
Further Details:      
 
Domain Number 4 Region: 829-951
Classification Level Classification E-value
Superfamily CheY-like 1.22e-30
Family CheY-related 0.0011
Further Details:      
 
Domain Number 5 Region: 565-648
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.51e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0024
Further Details:      
 
Domain Number 6 Region: 929-1056
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.0000000000000144
Family Phosphorelay protein-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77458091|ref|YP_347596.1|
Sequence length 1069
Comment Hpt sensor hybrid histidine kinase [Pseudomonas fluorescens Pf0-1]
Sequence
MIWPLRFVLLSILMLASTVHATEAQRLEIVSRTRLEGVQIQLDEQDRQWLRAHPVLRIGA
SWPDYPPFELTRKRHELEGLTADYADAIAQILNIDVEVWCHANRASAMAALKAGEVDLLG
TSNNFEIADPELMLSRAYAEDQPMWVTRLNEALPDDLAGKRIAMVDDYLPASTIEEAYPK
ASLQRYRSILDALGAVAFGRDDLYLGDFISASYLINTHFQNDLQLAGPSGLDANPFGFAL
ARSNIRLKRLVDKALLAIPMEQRLAMELRWSAGRADIAAQSRVSLSDSEQQWLDQHPVVR
VGAVDDFAPLTFFDTDGRFSGLVAQLLNLISQRSGLTFEVVRGQSLDRQVEQLRNGELDL
LPVMTPSRERETQMLFTRSYANSPFVLITESKAQAPRSLEEMAGKRLALYRGNPLRDYLL
EHVPQINLIELPSPADGTRALFDGRADATLSSLLVARYQIDHQYRERLRIASTLGDQPAR
IAMATAPDAPQLQSILNKALLGIAPQEIDGLVARWSRNVVLQDSYWQRHREQILRGFAVA
AGLLLLALGWIAFQRRQIRQRQQWLQQLQEAKDAADEANRAKSTFLATMSHEIRTPMNAL
IGMLELALKRADEGVTDRQAIEVASSAGQQLLALIGDILDIARIESGHLSLAPKRANLRE
VVASVCRIFEGLARQKQLLLHVELDERSDVEVMLDPLRFKQVVSNLLSNAIKFTEAGEVS
LCLRVFGEHGGLIEVGVAIEDSGRGISAEDQQRLFSPFVQVGDHRSVAHGGSGLGLVISR
NLCRLMGGDLWMNSELNRGTQVMLRLELPVLAPRVQKEEAAPAVAMTNSLAVLVVDDHPV
NRLLLCRQLSELGHRPVDTDGGERALALWRGQSFDALITDINMQGLNGYELTRAVRQEEA
ATGRAPCLILGFTANAQIEERQRCRAAGMNDCLFKPVLLRELSQALMAAGAETQVESLDE
SAVSEFDLSALLQLAGADNPLIEQLREEVRNSLRIDLQRLEASGLDRDVLRDLAHHVTGG
AHMIGAERVVSACRVLEQACRDDQPAAALTAAIDSLRVAMHDLAQQLQA
Download sequence
Identical sequences Q3KF49
WP_011333328.1.2668 205922.Pfl01_1864 gi|77458091|ref|YP_347596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]