SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77458467|ref|YP_347972.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77458467|ref|YP_347972.1|
Domain Number 1 Region: 90-288
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.53e-36
Family Phosphate binding protein-like 0.0026
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.98e-17
Family LysR-like transcriptional regulators 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77458467|ref|YP_347972.1|
Sequence length 292
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MIKELKTLIAVAREGTFAAAGNRIGLTQAAVSAQIQRLEAELGFEIFDRKGRTAHLNRMG
QQVLLQAQELLRLYDNLGSTTVGLSTRILVNVGAIASVQRSFLPDALARFHQQCPECRTR
VVPGLSMELVNLVDTGEIDMAAIIRPPFSLQSDLRWTTLALEPYRLIVPKDVPGEDWIEL
LSSLPFIRYDRSSFGGRQVDRFLRQMHFTLREVSELDELEAIIRLVENGVGVALVPQTAT
HQQWPSGVRALDLGQHTFHRDIGLVHRPRRSFTEPVRTLAELILEQFKVAAE
Download sequence
Identical sequences Q3KE23
gi|77458467|ref|YP_347972.1| WP_011333667.1.2668 205922.Pfl01_2240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]