SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77458579|ref|YP_348084.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77458579|ref|YP_348084.1|
Domain Number 1 Region: 14-337
Classification Level Classification E-value
Superfamily Radical SAM enzymes 3.66e-65
Family MoCo biosynthesis proteins 0.014
Further Details:      
 
Weak hits

Sequence:  gi|77458579|ref|YP_348084.1|
Domain Number - Region: 432-457
Classification Level Classification E-value
Superfamily RING/U-box 0.00733
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number - Region: 334-398
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.013
Family Phosphate binding protein-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77458579|ref|YP_348084.1|
Sequence length 487
Comment radical SAM family protein [Pseudomonas fluorescens Pf0-1]
Sequence
MTDNRPARYLSDTDLKRYVPVHVVWEITLACDLKCLHCGSRAGHRRPNELNTRECLEVID
SLAALGTREITLIGGEAYLRKDWTQLIRAIHDHGMYCAIQTGGRNLTPAKMQAAVDAGLN
GVGISLDGLAPLHDKVRNVSGSFDKAVDTLRRAKASGLAVSVNTQIGAATLPDLPELMDT
IIELGATHWQIQITVAMGNAVDHPELLLQPYKLLEVMPLLARLYREGLDRGLLMNVGNNI
GYYGPYEHLWRGFGDERVHWSGCAAGQTVLALEADGTVKGCPSLATVGFSGGNVRNMSLH
DIWHYSEGMHFGRLRSVDDLWGYCRSCYYNDVCRGGCTWTSHSLLGKPGNNPYCHYRTLE
LQKQGLRERIVKVEDAAQRSFAVGRFDLITERIDTGEKVSSVSDSGQVIKLAWINQGQSS
PEEGRLPTQLALCRDCLQYIHPHESICPHCRADVAAAEARHLNDRARQQAIMKTLTGLLA
GVPSSLS
Download sequence
Identical sequences Q3KDR1
gi|77458579|ref|YP_348084.1| WP_011333776.1.2668 205922.Pfl01_2352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]