SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77459007|ref|YP_348513.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77459007|ref|YP_348513.1|
Domain Number 1 Region: 92-297
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.16e-36
Family Phosphate binding protein-like 0.0063
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.43e-22
Family LysR-like transcriptional regulators 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77459007|ref|YP_348513.1|
Sequence length 310
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MRKPNLTDVSIFAAVVEAGGFRAAAQKRGLSASSLSDCIRRLEGDLGLRLLNRTTRSVTP
TAAGERLLERLRPALQEIDAAFNDLDDDAQRPVGTLKLNVPVPVARFLLPDLLARFLRLY
PGVNVEVVMDNTFVDVNAGGYDAGVRYEESLARDMIAVPIGPRRQRFVAAAAPCYLAERG
TPTQPEELPGHDLLGHRFESGKVGVFEFHRDGRVVRIPPQGQLLTSSHDLKIQSAINGLG
IVYTFEDFLREPLSDGRLVPILEDWWQAFDGPFLYYHGRRHMPSPLRAFVDFLRAERQLA
ESSSIFSAVS
Download sequence
Identical sequences A0A0C1WVY3 Q3KCI2
gi|77459007|ref|YP_348513.1| 205922.Pfl01_2782 WP_011334195.1.2668 WP_011334195.1.91687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]