SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77459105|ref|YP_348611.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|77459105|ref|YP_348611.1|
Domain Number - Region: 150-223
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0251
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.029
Further Details:      
 
Domain Number - Region: 63-104
Classification Level Classification E-value
Superfamily Photosystem I reaction center subunit XI, PsaL 0.0379
Family Photosystem I reaction center subunit XI, PsaL 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77459105|ref|YP_348611.1|
Sequence length 259
Comment hypothetical protein Pfl01_2880 [Pseudomonas fluorescens Pf0-1]
Sequence
MPFELSVDLTTLAVLALVAFIAGFIDAIAGGGGLLTTPALLTAGLPPHLVLGTNKLSSTF
GSATASFTFYRRKLFHPKQWMHAIVGTLVGALTGAIVAHYLPAEWLNKMLPVIVFACGLY
LLFGGTPKAPLDSDAPIKKKWQSTQGFSLGFYDGVAGPGTGAFWTVSSLLLYPIDLVKAS
GVARSMNFVSNIAALSVFVFSGQVDWIIGLSMGLSVMVGAFFGARTAISGGAKFIRPVFI
TVVLGLTVRLAWQHWFSVA
Download sequence
Identical sequences Q3KC84
gi|77459105|ref|YP_348611.1| WP_011334290.1.21389 WP_011334290.1.22023 WP_011334290.1.2668 WP_011334290.1.30523 WP_011334290.1.46399 WP_011334290.1.47897 WP_011334290.1.9994 205922.Pfl01_2880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]