SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77459515|ref|YP_349022.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77459515|ref|YP_349022.1|
Domain Number 1 Region: 32-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.62e-42
Family Phosphate binding protein-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77459515|ref|YP_349022.1|
Sequence length 315
Comment ABC transporter, substrate-binding protein, aliphatic sulfonates [Pseudomonas fluorescens Pf0-1]
Sequence
MKLSRFLRAALTSALFATPLTYAAEPLVLHVGDQNYYNIRASIEASGVLKDAPYTVDWKH
FQAAAPLAEALQTGSLDLGFLGDSGFLFLAAKQAPVKLIGVSRQNPDTIALLVPKDSPVK
TIEDLKGKKVAYWPGAWSQQLTLRALEQGGLPENYVDFVKLMPIDAAAALPQGSIDAFPV
WEPYISQQIVFSGARPILTAKNLMPGLSAIAASAPSIDSKREAIADFLGRLKQARAWVDS
HTDEYADLWAKKANLDQQVSRHWLRQAHMTVGPVDQQAAADLQSTADFLFKVKALPAPLA
TAGIIDSSFQQALAR
Download sequence
Identical sequences A0A2K4HPY5 Q3KB23
205922.Pfl01_3293 WP_011334669.1.15864 WP_011334669.1.2668 WP_011334669.1.53106 WP_011334669.1.58965 WP_011334669.1.96080 gi|77459515|ref|YP_349022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]