SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77459734|ref|YP_349241.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77459734|ref|YP_349241.1|
Domain Number 1 Region: 93-295
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.69e-44
Family Phosphate binding protein-like 0.00063
Further Details:      
 
Domain Number 2 Region: 5-115
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.62e-25
Family LysR-like transcriptional regulators 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77459734|ref|YP_349241.1|
Sequence length 304
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MAINFDLNDLQAFRAVVEQGSFRKAADTVRLSQPALSRRIEKLEDALGVKLFERTTRKVS
LTQAGRGFMPSVERLLDDLDVALLGISEVASNRQGHVTVACVPSAAYYFMPSVVARYHRQ
FPRIKVKVLDSSAHDVLSAVVNGEADFGLSFMGTQEAGVDFEPLVQESYVVACRRDHPLA
GRSSVTWDEFYRQDYISLDKTSGNRFLLDQALAKVVPQRPSICETRHVTTMIGLVEAGLG
VAAVPLMAMPAADHPILTRVPLTDPQVMRSVGIIKRRGRTLTPAALELERLVVEMKVQPP
TVSA
Download sequence
Identical sequences Q3KAF4
WP_011334875.1.1491 WP_011334875.1.22023 WP_011334875.1.2668 WP_011334875.1.30523 WP_011334875.1.31280 WP_011334875.1.39127 WP_011334875.1.46342 WP_011334875.1.46399 WP_011334875.1.47897 WP_011334875.1.55686 WP_011334875.1.66386 WP_011334875.1.77688 205922.Pfl01_3512 gi|77459734|ref|YP_349241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]