SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77459872|ref|YP_349379.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77459872|ref|YP_349379.1|
Domain Number 1 Region: 31-51,82-354
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.72e-61
Family Phosphate binding protein-like 0.00016
Further Details:      
 
Domain Number 2 Region: 319-443
Classification Level Classification E-value
Superfamily OmpA-like 6.8e-21
Family OmpA-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77459872|ref|YP_349379.1|
Sequence length 444
Comment OmpA/MotB [Pseudomonas fluorescens Pf0-1]
Sequence
MTLRVLFVFLLSAWLQVSAAALPIPENGPVLRIQGSNTIGAALGPALVEGLLQDQGLLKV
HSETPDTANEQRIVGLTAQGQRVVVEIAAHGSSTGFTALKNASADLAASSRPIKDSELLN
LQARGDLKSPGAEQVIAIDGLAIILHPDNSLNQLNTEQLARIFSGEAKTWEDVGGKGGTI
HLYARDDQSGTYDTFKELVLSRRGKSLSNAAKRFESSEQLSDAVSADPQAIGFIGLPYVR
QAKAVAIVDGQSQAMLPLASLIATEDYPLSRRLFFYLPPDSNNPWARALVEFAQSRQGQA
IVAANGFIAQTVQAIAVTPNALMPEGYQSLSRHAQRLTVNFRFEEGSASLDNKARQDLAR
VFDYIKHHDKTDRAVTLVGFGDAKDDPARADLLSKLRAMAVRRELVKNGVVLREVRGFGA
LMPVATNSGDEGRIKNRRVEVWVY
Download sequence
Identical sequences Q3KA16
gi|77459872|ref|YP_349379.1| WP_011334995.1.2668 205922.Pfl01_3650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]