SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77459874|ref|YP_349381.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77459874|ref|YP_349381.1|
Domain Number 1 Region: 90-295
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.52e-48
Family Phosphate binding protein-like 0.0000325
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.53e-18
Family LysR-like transcriptional regulators 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77459874|ref|YP_349381.1|
Sequence length 314
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MNLSKVDLNLFIVFDAIYTEANLTRAGQIVGITQPAVSNALARLRETFNDPLFVRTAQGM
VPTPMAQNIIGPVRNALSLLRVSVQESRIFNPSQAVKTYRISMTDLTEAVILPPLFQRLR
RLAPTVIIESFLSKRRETTKELAAGRLDFAVDAPLNTDPQVRHVKLMEDRYVCAMRKGHP
LATKEKFTLDDYLSLTHIHISSRRSGLGHVDLALGKMGIQRKIALRSQHYLMASQVLQQT
DMVMTVPERFARRHDLHAFNLPVNDVPPVETHLYWHESTDQDPANRWMREQMIELCQQVT
AHEKKLDKLQAPAT
Download sequence
Identical sequences A0A173J499 A0A2A5R3Z4 Q3KA14
WP_011334997.1.1491 WP_011334997.1.15864 WP_011334997.1.2668 WP_011334997.1.31280 WP_011334997.1.32803 WP_011334997.1.39127 WP_011334997.1.46058 WP_011334997.1.46342 WP_011334997.1.47299 WP_011334997.1.53106 WP_011334997.1.54387 WP_011334997.1.54700 WP_011334997.1.55575 WP_011334997.1.55686 WP_011334997.1.55954 WP_011334997.1.58965 WP_011334997.1.62013 WP_011334997.1.66221 WP_011334997.1.66386 WP_011334997.1.72974 WP_011334997.1.77688 WP_011334997.1.84829 WP_011334997.1.8936 WP_011334997.1.91867 WP_011334997.1.96080 WP_011334997.1.9973 205922.Pfl01_3652 gi|77459874|ref|YP_349381.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]