SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77459886|ref|YP_349393.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77459886|ref|YP_349393.1|
Domain Number 1 Region: 4-178
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.96e-34
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77459886|ref|YP_349393.1|
Sequence length 181
Comment cytochrome B561 [Pseudomonas fluorescens Pf0-1]
Sequence
MSTQPTHFNPLARLLHWLMALMIIAMLFIGAGMVTSVSARHEWLINLHKPLGIAILALVI
VRILVRLGTRQPPLPADLPGWQVMAAKASHLLLYALMLVLPLLGWAMISAAGDPVMLGTS
LQLPSIVPADAQVFALLRKAHGYLAYLLFLTVLLHLAAALFHGWVRRDEVLDSMLRGRNR
G
Download sequence
Identical sequences A0A0C1X088 A0A1G5MYU0 A0A1G6BXG4 A0A2K4HMB8 Q3KA02
gi|77459886|ref|YP_349393.1| 205922.Pfl01_3664 WP_011335009.1.20937 WP_011335009.1.22023 WP_011335009.1.2668 WP_011335009.1.30523 WP_011335009.1.38776 WP_011335009.1.46399 WP_011335009.1.47897 WP_011335009.1.51676 WP_011335009.1.55771 WP_011335009.1.58385 WP_011335009.1.64081 WP_011335009.1.6588 WP_011335009.1.75567 WP_011335009.1.91175 WP_011335009.1.91687 WP_011335009.1.98588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]