SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77459929|ref|YP_349436.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77459929|ref|YP_349436.1|
Domain Number 1 Region: 87-291
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.71e-28
Family Phosphate binding protein-like 0.01
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.45e-21
Family LysR-like transcriptional regulators 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77459929|ref|YP_349436.1|
Sequence length 299
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MLNYRQLHYFWVVAKTGSIVRACEQLNLTPQTISGQISLLEQTYGIELFQRVGRQLELTE
AGRQALPYAEQMFQLGGELELMLRAQPNEQQILFRVGVADVVPKSIVYRLIAPTMELSEP
LRITCREDKLERLLADLAIQRLDLVISDSPMPSHLDIKGYSQKLGECGISFFATAELAAQ
YGQDFPRSLHGAPLLIPGAETVVRSRLQRWFAEQQIQPRIVGEFDDSALMQAFGQSGSGI
FIGPSVIADEVKRQYGVELIGQTDAVSESFYAISVERKVKHPGIKAITEGARRELFTAF
Download sequence
Identical sequences A0A0C1X0C4 A0A1G5N0E3 A0A1G6BYH8 A0A2K4HM93 J2PL58 Q3K9V9
gi|77459929|ref|YP_349436.1| WP_007951569.1.15864 WP_007951569.1.20937 WP_007951569.1.21389 WP_007951569.1.21564 WP_007951569.1.22023 WP_007951569.1.2668 WP_007951569.1.32803 WP_007951569.1.46399 WP_007951569.1.47897 WP_007951569.1.51676 WP_007951569.1.53106 WP_007951569.1.58385 WP_007951569.1.58965 WP_007951569.1.64081 WP_007951569.1.6588 WP_007951569.1.75567 WP_007951569.1.85257 WP_007951569.1.91175 WP_007951569.1.91687 WP_007951569.1.96080 WP_007951569.1.9973 WP_007951569.1.9994 205922.Pfl01_3707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]