SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77460196|ref|YP_349703.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77460196|ref|YP_349703.1|
Domain Number 1 Region: 772-947
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.26e-44
Family Histidine kinase 0.0043
Further Details:      
 
Domain Number 2 Region: 307-527
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.89e-37
Family Phosphate binding protein-like 0.0029
Further Details:      
 
Domain Number 3 Region: 967-1087
Classification Level Classification E-value
Superfamily CheY-like 8.11e-33
Family CheY-related 0.001
Further Details:      
 
Domain Number 4 Region: 52-277
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.81e-31
Family Phosphate binding protein-like 0.0068
Further Details:      
 
Domain Number 5 Region: 699-783
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 6.47e-19
Family Homodimeric domain of signal transducing histidine kinase 0.0026
Further Details:      
 
Domain Number 6 Region: 1067-1181
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 3.01e-17
Family Sensor-like histidine kinase YojN, C-terminal domain 0.087
Further Details:      
 
Domain Number 7 Region: 566-694
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000297
Family Heme-binding PAS domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77460196|ref|YP_349703.1|
Sequence length 1214
Comment multi-sensor hybrid histidine kinase [Pseudomonas fluorescens Pf0-1]
Sequence
MSSRLMSFLIAWSACLGFCTSSTAASPASQDFTLLGRSADRSVQALFDPSQVAWAHTRNE
LILGTSAPDYPPFDMTASGHDYEGFTADYAVLVGQAIGLPIRVKRFASREAAIRALIDGH
IDMLGTANGFEAENADIVLSRPYAIDQPVLVTREGETRTLTEGLAGMRLSMLYHYLPLDD
VKAMYPKALITSYPSYQNAINAVAFDQADVFLGDTISTHYMISKGYLNNIRMANFGKHEA
HGFSFAVHRNNPQLLAIIDTVLKAVPGSERENIAKRWSVGSDTLLTDQKLQLTKREEQWL
KKHSVVSVVVNEAFAPLTFFDSDGNFRGISADLLELIRLRTGLRFEIRRSRSDAEMIKQV
EHHQADLIAALLPTAQREETLNFSRPYLENSYVLLTRKAADSPTHLGQLKRKRLAIAQGN
PMIEYLRSEFPRIQLIETPDTFSAVALLDEGQVEGAVNSLVIANYFIASRTFEHPLQITT
TIGTRQAAFSLATARDNTELSSIIDKSLMSITPEELGIINGRWRGYSSVSQGTWRQYQRF
FYQVIGGACLLLLLSLLWNAYMRRQIKQRKAAERALNDQLEFMGSLVNGTPHPIYVRDRQ
GLLQSCNDSYLQAFNARREDVIGKSVMQGALNNAFEAQTYQADYQRVMAEGRPLVLDRPL
QIGNRQLTIYHWILPYRDSSGEVQGIIGGWIDISERRELLDELRAAKERADDANRAKSTF
LATMSHEIRTPMNAVIGMLELTLKRMDQTHPDRSGIETAYHSAKDLLGLIGDILDIARIE
SGRLSLTPERINLIDTVGSVVRIFEGLARQKQLSLAVSVSPPELNVDVHLDPLRFKQVLS
NLISNAIKFTEAGHIRITLDVLPTDDPERSMVQLTVQDSGIGITTQDQSRLFEPFAQAAN
GGQRTFSGAGLGLVISRNLCEMMGGKLRLSSLPGIGTQVSVSLPVVILPAQVARAEDEPE
IQASLIPLTVLVVDDHPANRLLMCQQLEYLGHRFCIAEDGQQGLEQWKNGEFDLVIADCN
MPVMNGYDLTRAIRKHETLTRRPACTVLGFTANAQPEEILRCKQAGMNDCLFKTLSLNSL
SEWVNSVQPLFRAPVFNLQGLTLLTGGNPSQTHRLLAELLNSSRLDRQELQALSLTRDPP
ALAIIAHKIKGAARIVQASRLIDSCEALEQACQQALPGDEIERRCQASRLAILELEQALE
QQLNRISQSKVTRA
Download sequence
Identical sequences Q3K942
205922.Pfl01_3975 gi|77460196|ref|YP_349703.1| WP_011335285.1.2668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]