SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77460214|ref|YP_349721.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77460214|ref|YP_349721.1|
Domain Number 1 Region: 107-294
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.03e-24
Family Phosphate binding protein-like 0.0044
Further Details:      
 
Domain Number 2 Region: 17-128
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.44e-23
Family LysR-like transcriptional regulators 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77460214|ref|YP_349721.1|
Sequence length 296
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MFLMACITEIHQLSAYPSIDTDVLRTFVAIADQGGFTRAGEMVNRTQSAVSMQMKRLEED
VLQRQLFERDGRQVRLTAEGQVLLGYARRILKLHSEVFNTLREPHMVGTVRIGTPDDYVM
RFLPGILSRFAQFYPLIQIEVHCESTKQLLQRTDLDLSIVTREPGNEIGQLLRKERFVWA
EAQNFSAHEQTPLPLAMFNSDCFCRLWACNALDAMGREYRIAYNSTSLSALMAVVSAGLA
ITAQLESLITPDMRILGDAENLPLLPEASIMLIRNLNNPSPITECLAEHIVEGFKL
Download sequence
Identical sequences A0A1G5M2D6 A0A2K4HKZ7 Q3K924
WP_011335298.1.20937 WP_011335298.1.2668 WP_011335298.1.30523 WP_011335298.1.38776 WP_011335298.1.51676 WP_011335298.1.55771 WP_011335298.1.58385 WP_011335298.1.64081 WP_011335298.1.6588 WP_011335298.1.75567 WP_011335298.1.91175 WP_011335298.1.91687 WP_011335298.1.98588 gi|77460214|ref|YP_349721.1| 205922.Pfl01_3993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]