SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77460297|ref|YP_349804.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77460297|ref|YP_349804.1|
Domain Number 1 Region: 95-280
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.64e-61
Family Phosphate binding protein-like 0.0000905
Further Details:      
 
Domain Number 2 Region: 266-361
Classification Level Classification E-value
Superfamily ACT-like 8.1e-28
Family Phenylalanine metabolism regulatory domain 0.0078
Further Details:      
 
Domain Number 3 Region: 5-98
Classification Level Classification E-value
Superfamily Chorismate mutase II 9.89e-19
Family Dimeric chorismate mutase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77460297|ref|YP_349804.1|
Sequence length 364
Comment prephenate dehydratase [Pseudomonas fluorescens Pf0-1]
Sequence
MSEQELKALRVRIDNLDEKILQLISDRARCAEEVARVKMASLAEGEQPVFYRPEREAQVL
KRVMERNKGPLGNEEMARLFREIMSSCLALENPLKVAYLGPEGTFTQAAAMKHFGHAVIS
KPMAAIDEVFREVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLL
VGENTKTDSISRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAG
DMAAGLYGLTRLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSNKPGALHELLV
PFHDNGIDLTRIETRPSRSGKWTYVFFIDFVGHHRDPLIKGVLEKISQEAVALKVLGSYP
KAVL
Download sequence
Identical sequences A0A0C1W7J1 A0A173J5U9 A0A1G5M1Y1 A0A1G6AXE8 A0A2K4H7I6 J3FEJ5 Q3K8U1
WP_007950913.1.15864 WP_007950913.1.20937 WP_007950913.1.21389 WP_007950913.1.21564 WP_007950913.1.22023 WP_007950913.1.2668 WP_007950913.1.30523 WP_007950913.1.32803 WP_007950913.1.38776 WP_007950913.1.46058 WP_007950913.1.46399 WP_007950913.1.47299 WP_007950913.1.47897 WP_007950913.1.51676 WP_007950913.1.53106 WP_007950913.1.54387 WP_007950913.1.54700 WP_007950913.1.55575 WP_007950913.1.55771 WP_007950913.1.55954 WP_007950913.1.58385 WP_007950913.1.58965 WP_007950913.1.62013 WP_007950913.1.64081 WP_007950913.1.6588 WP_007950913.1.66221 WP_007950913.1.72974 WP_007950913.1.75567 WP_007950913.1.84829 WP_007950913.1.85257 WP_007950913.1.8936 WP_007950913.1.91175 WP_007950913.1.91687 WP_007950913.1.91867 WP_007950913.1.96080 WP_007950913.1.98588 WP_007950913.1.9973 WP_007950913.1.9994 205922.Pfl01_4076 gi|77460297|ref|YP_349804.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]