SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77460359|ref|YP_349866.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77460359|ref|YP_349866.1|
Domain Number 1 Region: 61-233
Classification Level Classification E-value
Superfamily Chorismate lyase-like 4.08e-19
Family UTRA domain 0.015
Further Details:      
 
Domain Number 2 Region: 8-75
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.85e-16
Family GntR-like transcriptional regulators 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77460359|ref|YP_349866.1|
Sequence length 237
Comment GntR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MIRQVRFDKKQRVVDELVRRIESGLMEDGFLLPGEHQLAQEFNVSRGTLREALAELKRRN
YIATQSGVGSIVTFDGVVLDQRSGWAQALADSGALINTDVLRLEAVTREDLLPRFGSDQF
ILLERRRRSNDGTAVSLERSLMPASGGLESLPRVGLIDNSLTITLAAYGYIGERGDQWIG
AEPLNAVDAKLLGRPEGTVFLKALRTTYDRQNRFMEQVESLLDPVHFRLHLQFGESK
Download sequence
Identical sequences Q3K8M9
WP_011335421.1.2668 205922.Pfl01_4138 gi|77460359|ref|YP_349866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]