SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77460513|ref|YP_350020.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77460513|ref|YP_350020.1|
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.41e-70
Family Phosphate binding protein-like 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77460513|ref|YP_350020.1|
Sequence length 257
Comment lysine-arginine-ornithine-binding periplasmic protein [Pseudomonas fluorescens Pf0-1]
Sequence
MKKLVLLGALALSVLSLPTFADEKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEE
MKVKCQWVEQEFDGLIPALKVRKIDAILSSMSITDDRKKSVDFTNKYYNTPARLVMKEGT
QVSEGLAELKGKNIGVQRGSIHERFAREVLAPLGAEIKPYGSQNEIYLDVAAGRLDGTVA
DATLLNDGFLKTDAGKGFAFVGPAFTDVKYFGDGVGIAVRKGDALKDKINTAIAAIRENG
KYKAIQDKYFDFDIYGK
Download sequence
Identical sequences A0A0C1ZGT0 A0A173J8Z8 A0A1G5M3W5 A0A1G6B3Z4 A0A2K4HNN1 Q3K875
WP_011335541.1.15864 WP_011335541.1.20937 WP_011335541.1.2668 WP_011335541.1.32803 WP_011335541.1.51676 WP_011335541.1.53106 WP_011335541.1.54387 WP_011335541.1.54700 WP_011335541.1.58385 WP_011335541.1.58965 WP_011335541.1.62013 WP_011335541.1.64081 WP_011335541.1.6588 WP_011335541.1.72974 WP_011335541.1.75567 WP_011335541.1.84829 WP_011335541.1.91175 WP_011335541.1.91687 WP_011335541.1.91867 WP_011335541.1.96080 205922.Pfl01_4292 gi|77460513|ref|YP_350020.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]