SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77460545|ref|YP_350052.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77460545|ref|YP_350052.1|
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.25e-23
Family LysR-like transcriptional regulators 0.0041
Further Details:      
 
Domain Number 2 Region: 82-265
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000000011
Family Phosphate binding protein-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77460545|ref|YP_350052.1|
Sequence length 278
Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MDIRHLKAFLAVFEERNITAAAQRLFISQPTLSVTIKQLEEELGATLFVRQPRGVEVSDE
ARLLYPQARRMVAESEALSRMFRGRENRAPLTLGIEGDIAASHIEAFVRMAHQALPNLLL
TLEEGCHGDGRLAVEEMCCEDELFLPLWEESYVMALPLDHPMANAQAGWAPIEDWITCPQ
HPSHQRLMALYGRSPEAVAGHAGSLQQALHMVAAGVGVAMLPQSLVSGHEHIVVRALHLP
APTRRVGLCYAAQALELPTMRGLHAYFQVNRPAAIEAA
Download sequence
Identical sequences Q3K843
WP_011335571.1.2668 205922.Pfl01_4324 gi|77460545|ref|YP_350052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]