SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77460591|ref|YP_350098.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77460591|ref|YP_350098.1|
Domain Number 1 Region: 32-431
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.09e-53
Family Phosphate binding protein-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77460591|ref|YP_350098.1|
Sequence length 433
Comment extracellular solute-binding protein [Pseudomonas fluorescens Pf0-1]
Sequence
MNAISRLATVISVASLFPLAVLPLSVSAAESKGSVEVVHWWTSGGEKAAVDVLKAQVEKD
GFTWKDGAVAGGGGATAMTVLKSRAVAGNPPGVAQIKGPDIQEWASTGLLDTDVLKDVSK
SEKWDSLLDKKVSDTVKFEGDYVAVPVNIHRVNWLWINPEVFKKAGIEKAPTTLEEFYAA
GDKLKAAGFIPLAHGGQPWQDSTVFEAVVLSVMGVDGYKKALVDLDNAALTGPEMVKALT
ELKKVATYMDQDGKGQDWNLEAAKVINGKAGMQIMGDWAKSEWTAAKKVAGKDYECVAFP
GTDKAFTYNIDSLAVFKQKDAGTAAGQQDIAKVVLGENFQKVFSINKGSIPVRNDMLADM
GKYGFDSCAQTAAKDFLADAKNGGLQPSMAHNMATTLAVQGAFFDVVTNYINDPKADPAD
AAKKLGTAIKAAK
Download sequence
Identical sequences J2PP37 Q3K7Z7
205922.Pfl01_4370 WP_007951167.1.15864 WP_007951167.1.21564 WP_007951167.1.22023 WP_007951167.1.2668 WP_007951167.1.30523 WP_007951167.1.32803 WP_007951167.1.38776 WP_007951167.1.46399 WP_007951167.1.47897 WP_007951167.1.53106 WP_007951167.1.55771 WP_007951167.1.58965 WP_007951167.1.96080 WP_007951167.1.98588 gi|77460591|ref|YP_350098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]