SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77461345|ref|YP_350852.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77461345|ref|YP_350852.1|
Domain Number 1 Region: 25-344
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.84e-63
Family Phosphate binding protein-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77461345|ref|YP_350852.1|
Sequence length 347
Comment extracellular solute-binding protein [Pseudomonas fluorescens Pf0-1]
Sequence
MLRSLKFTALTLGLMGAASAMAAGPDLTVVSFGGANKAAQVKAFYAPWEAAGNGKIVAGE
YNGEMAKVKAMVDTKSVSWDLVEVESPELSRGCDEDMFEQLDPALFGKSEDYVKGAIQPC
GVGFFVWSTVLAYNADKLKTAPTSWADFWDTKKFPGKRGLRKGAKYTLEFALMADGVAPK
DVYKELASKGGQDRAFKKLDELKPNIQWWEAGAQPPQYLASGDVVMSSAYNGRIAAVQKE
SNLKVVWNGGIYDFDAWAIPKGLDAKRAEAAKKFIAFSVQPQQQKTYSENIAYGPANSQA
VPLLDKAILKDMPTTPENIANQVQIDVSFWADNGEQLEQRFNSWAAK
Download sequence
Identical sequences A0A0C1ZZJ6 A0A173J9F7 A0A1G5P262 A0A1G6F7W2 A0A2K4HXE7 J2NZI2 Q3K5U3
gi|77461345|ref|YP_350852.1| 205922.Pfl01_5124 WP_007959933.1.15864 WP_007959933.1.20937 WP_007959933.1.21389 WP_007959933.1.21564 WP_007959933.1.2668 WP_007959933.1.38776 WP_007959933.1.51676 WP_007959933.1.53106 WP_007959933.1.54387 WP_007959933.1.54700 WP_007959933.1.55771 WP_007959933.1.58385 WP_007959933.1.58965 WP_007959933.1.62013 WP_007959933.1.64081 WP_007959933.1.6588 WP_007959933.1.72974 WP_007959933.1.75567 WP_007959933.1.84829 WP_007959933.1.85257 WP_007959933.1.91175 WP_007959933.1.91687 WP_007959933.1.91867 WP_007959933.1.96080 WP_007959933.1.98588 WP_007959933.1.9973 WP_007959933.1.9994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]