SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77461348|ref|YP_350855.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77461348|ref|YP_350855.1|
Domain Number 1 Region: 41-266
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.25e-31
Family Phosphate binding protein-like 0.0043
Further Details:      
 
Domain Number 2 Region: 339-449
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.33e-23
Family Heme-binding PAS domain 0.021
Further Details:      
 
Domain Number 3 Region: 673-795
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.76e-20
Family Histidine kinase 0.025
Further Details:      
 
Domain Number 4 Region: 437-570
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.53e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77461348|ref|YP_350855.1|
Sequence length 799
Comment PAS/PAC sensor Signal transduction histidine kinase [Pseudomonas fluorescens Pf0-1]
Sequence
MMRFCCLWVIGCLAFPLMGWAAPAPPSHLARLSASEQQWLAQHNELRVGLVLQAPYAQYD
RRLQRLSGANVEVMKALARALNVELSWRNFQDLAQLEAAARDGEIDIAPGLTQTPGGLRL
WQFSDPYMRVPQLVVSDQKSSATVELEKLDSQTRVAVRMPGVTADYLRGNYPHLNLQGVP
MERQALQLLLSQQASYAVVDEAQLGRLSAEPEFAGLVVVGDIGLPQLLRIGTRRDWPELA
GIVESALRAIPAKDLERLHAQWLQPKYPRLSESPGFWQNLSLLFAVLLLSCVAIVFWQRR
QQRSLEQRLFDAREDIALRAASEEALRLTQFSIDQSTVGILWVNWDSHVRYANRAAENML
GYPQGAIIDRPLIDFEPGLHMDRWLNLWKRARASEEGPLSFETNCVRADGSVLPADVSLS
FLRFRDGEYLVVYLTDVTERRRALAALQESEARLQGIAANVPGLVFRLERAPVTGQIDFA
YISEGSESLVGYAPAAIAHRDMGLRSLVHPDDRAAYHQTQDQALDTDSDWSWQGRILTRQ
GEQRWAEIKAITRQLEGGSYVWDGIVWDITESKRIELELAASREQLRELSAHLESVREEE
KARIAREVHDELGQMLTVLKLETSMCELAYAQLDPGLNERLNSMKRLIAQLFQLVRDVAT
ALRPPILDAGIASAIEWQARRFEARTQIPCLVQVPDNLAPLSDAKAIGLFRILQEALTNV
MRHAQAHTVELTLTQEGDELCLTVSDDGVGFVAAAGRPTSFGLVGMRERVLIMGGQLSLD
SEPGEGTTLSVRVPLDEEK
Download sequence
Identical sequences Q3K5U0
WP_011336201.1.2668 205922.Pfl01_5127 gi|77461348|ref|YP_350855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]