SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77461371|ref|YP_350878.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77461371|ref|YP_350878.1|
Domain Number 1 Region: 984-1233
Classification Level Classification E-value
Superfamily EAL domain-like 3.01e-91
Family EAL domain 0.0014
Further Details:      
 
Domain Number 2 Region: 813-970
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.06e-49
Family GGDEF domain 0.00012
Further Details:      
 
Domain Number 3 Region: 39-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.19e-49
Family Phosphate binding protein-like 0.0016
Further Details:      
 
Domain Number 4 Region: 688-795
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-26
Family Flavin-binding PAS domain 0.045
Further Details:      
 
Domain Number 5 Region: 423-548
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.81e-21
Family Heme-binding PAS domain 0.012
Further Details:      
 
Domain Number 6 Region: 547-673
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.4e-19
Family Heme-binding PAS domain 0.08
Further Details:      
 
Domain Number 7 Region: 297-424
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.83e-16
Family BphP N-terminal domain-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77461371|ref|YP_350878.1|
Sequence length 1248
Comment diguanylate cyclase/phosphodiesterase [Pseudomonas fluorescens Pf0-1]
Sequence
MPRLASVLFLLPLMIWTATADALTLNDEERSWLAAHPDLRLGVDASWPPFEFRDDQSRYQ
GLAADYIDVIRQRLAIKLTPIEPVSWTVVLEQAKNGTIDLLPGIMSTPERQSYLSFTRPY
LDFPIVILAHVGGPQPHKLEDLYGLKIAVVENYAPHELLRTHHPDLNLVAMPNVSSALQA
LATDEVDAVVGDLASSVWSLRQLKLDGLYVSGETPYRYQLAMGVPRDNKMLVGILDKVLA
DMSPEEISSIQEHWVGNVLDHRTFWSDLLIYGLPGLSLLVIVLAVVIRINRRLSSEIARR
IDLEQELRSSEYHYRGLVESLSAIAWEARISDFTYSYVSPHAEDLLGYPLSHWLIPGFWR
NIIHPADLTRAQSFCDHEVLAGRDHSLDYRVITADGRCLWVRDIVSLIEHGHEPVMRGLM
IDISETKRTEEALRLSEQKFASVFQQCPDILVIARLSDGCLLEVNEAFEEQIGLKAEEVI
GQTATELNIWGIPGVGPGLLQRLQAGSIRNLEMPFRRNNGQVFTGLISAEPFELDTTPAL
VVVVRDITQLKETQQQLQTSEEKFAKAFHASPDGLLLSRQSDGLLLEVNEGFSRITGFNS
AMSVDRSALDLGIWVNLNERKQMLDLLHRDGFVRDFSCHIRRSDGQIRLCEVSSRPLPIG
DEDCMLTIARDITERHLMQEKLQQAATVFESTAEGVLITDTQQHISAVNRAFTEITGYSE
SEALGHTPRLLASGLHDSAFYAAMWHQLTDEGHWQGEISNRRKNGELYPSWLTISAVRNR
DKFITHFVAVFADISSLKHAQAKLDYQAHHDPLTGLPNRTLFESRLLTALNSQQENGGQG
AVLFLDLDRFKHINDSLGHPVGDLLLKGIAVRLKEQLRDIDTVARLGGDEFIILLPGLQQ
PGDADNIATKLLNCFGAPFQAGEHEFFISASIGTSLYPRDGCDVATLIKNADAAMYRSKA
KGRNRVESYTRDLTAQASERVALEHELRRAIEREELYLYYQPKISLDDHSLVGAEALIRW
RHPNFGEVPPEHFIPLAEENGMILQIGDWVLETACRQMFEWGQIYESLGPLSVNLAGAQL
RQPNLLGRIEQLLKDNRLRPELLQLEITENFIMSQAEEALAVLHQLKHLGVQLAIDDFGT
GYSSLSYLKRLPLDILKIDQSFVRGLPDDPHDAAIVRAIIALGRSMQFTVIAEGVETQAQ
QQFLAAEGCEQIQGYIVSLPLPPEEFAATFLRISVSDFSDSTAEKPSL
Download sequence
Identical sequences Q3K5R7
205922.Pfl01_5150 WP_011336220.1.2668 gi|77461371|ref|YP_350878.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]