SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77461399|ref|YP_350906.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77461399|ref|YP_350906.1|
Domain Number 1 Region: 9-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.83e-25
Family N-terminal domain of molybdate-dependent transcriptional regulator ModE 0.00024
Further Details:      
 
Domain Number 2 Region: 113-181
Classification Level Classification E-value
Superfamily MOP-like 0.00000000000000151
Family BiMOP, duplicated molybdate-binding domain 0.061
Further Details:      
 
Domain Number 3 Region: 189-252
Classification Level Classification E-value
Superfamily MOP-like 0.000000298
Family BiMOP, duplicated molybdate-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77461399|ref|YP_350906.1|
Sequence length 254
Comment ModE family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence
MSLPSLLSQHIVRRPQRIALLQHIAEQGSITRAAKSAGLSYKAAWDAIDELNNLAQKPLV
ERAVGGKGGGGARLSSEGERVLRLYQKLQALQAQVLEAAEDASDLDLLGRLMLRTSARNQ
LHGKVVLIEGQGRNDLIRLELAEGLSIDAQITHDSTVHLELQPGTEVVALIKAGWLELLA
PQATPAVGHNLLSGRIEAILDAEDGPSEVRIALPNGQTLCALAEPLDLRTRGLTVEQAVQ
VQFSPSNVLLGTPL
Download sequence
Identical sequences Q3K5N9
205922.Pfl01_5178 WP_011336246.1.2668 gi|77461399|ref|YP_350906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]