SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77461506|ref|YP_351013.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77461506|ref|YP_351013.1|
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.37e-39
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77461506|ref|YP_351013.1|
Sequence length 183
Comment cytochrome B561 [Pseudomonas fluorescens Pf0-1]
Sequence
MQLRNSSSRYGWVSIFMHWGVALAVFGLFALGLWMVGLDYYSTWRKDAPDLHKSIGLVLL
AVMVLRVLWRFVSPPPPTLQSYSRMTRIGAKFGHGFLYLALFAVMIAGYLISTADGVGIP
VFGLFEVPALVSGLPDQADTAGVIHLYLAWALVIFSGLHALAALKHHFIDRDATLTRMLG
RKA
Download sequence
Identical sequences Q3K5D2
WP_011336344.1.22023 WP_011336344.1.2668 WP_011336344.1.30523 WP_011336344.1.46399 WP_011336344.1.47897 205922.Pfl01_5285 gi|77461506|ref|YP_351013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]