SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77461680|ref|YP_351187.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77461680|ref|YP_351187.1|
Domain Number 1 Region: 8-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.45e-53
Family Phosphate binding protein-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77461680|ref|YP_351187.1|
Sequence length 261
Comment extracellular solute-binding protein [Pseudomonas fluorescens Pf0-1]
Sequence
MTKRYSALLAALFAGLMLSQAPAHADGLDDVVKRGTLKVAVPQDFPPFGSVGPDMKPRGL
DIDTAKLLAEQLKVKLELTPVNSTNRIPFLTTGKVDLVISSLGKNPEREKVIDFSRAYAP
FYLAVFGPPDAAVSTLDDLKGKTISVTRGAIEDIELTKVAPEGVTIKRFEDNNSTIAAYL
AGQVDLIASGNVVMVAISEKNPKRVPALKVKLKDSPVYVGVNKNEPALLGKVNEILTTAK
ADGALEKNAQTWLKEPLPADL
Download sequence
Identical sequences A0A173J982 Q3K4V8
205922.Pfl01_5459 WP_011336488.1.2668 WP_011336488.1.38776 WP_011336488.1.54700 WP_011336488.1.55771 WP_011336488.1.98588 gi|77461680|ref|YP_351187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]