SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77461708|ref|YP_351215.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77461708|ref|YP_351215.1|
Domain Number 1 Region: 4-219
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.45e-84
Family Phosphate binding protein-like 0.0000000642
Further Details:      
 
Domain Number 2 Region: 220-309
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.57e-26
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77461708|ref|YP_351215.1|
Sequence length 313
Comment porphobilinogen deaminase [Pseudomonas fluorescens Pf0-1]
Sequence
MSSREIRIATRKSALALWQAEYVKARLEAAHPGLLVTLVPMVSRGDKLLDSPLSKIGGKG
LFVKELETALLENEADIAVHSMKDVPMDFPEGLGLFCICEREDPRDAFVSNTYSSLDALP
AGSIVGTSSLRRQAQLLTRRPDLEIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLGFE
DRITSAISVDDSLPAGGQGAVGIECRSADTEIHALLAPLHHADTADRVTAERALNKHLNG
GCQVPIACYAVLEGDQLWLRGLVGEPSGGKLLNAQARAPRAAAETLGVQVAEDLLSQGAD
DILKAVYGEAGHE
Download sequence
Identical sequences Q3K4T0
WP_011336515.1.2668 gi|77461708|ref|YP_351215.1| 205922.Pfl01_5487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]