SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77456451|ref|YP_345956.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77456451|ref|YP_345956.1|
Domain Number 1 Region: 24-265
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.37e-80
Family Phosphate binding protein-like 0.00000917
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77456451|ref|YP_345956.1|
Sequence length 265
Comment NLPA lipoprotein [Pseudomonas fluorescens Pf0-1]
Sequence
MKKVLLFTALAAALTASLAQAGEKLVVAATPVPHAEILELIKPTLAKEGVDLEIKVFTDY
VQPNVQVGEKRLDANYFQTKPYLDSFNAGKYKDDKAKYLVTVQGVHVEPFGGYSSKYKTL
AELPDGATIAIPNEGSNSGRALILLQKAGLIELKDPKNALATPKDIAKNPHNFKFKELES
ALLPRVLKEVDLDMINTNYALEAKLNPTKDALVIEGADSPYVNFLVAREDNKNSDAIKKL
AAALTSPEVKAFIEKKYNGAVLPAF
Download sequence
Identical sequences A0A0C2A7M7 A0A173IVX3 A0A1G5N9C5 A0A1G6CD86 A0A2K4HUC6 Q3KJT9
WP_011331930.1.15864 WP_011331930.1.20937 WP_011331930.1.21389 WP_011331930.1.2668 WP_011331930.1.38776 WP_011331930.1.51676 WP_011331930.1.53106 WP_011331930.1.54387 WP_011331930.1.54700 WP_011331930.1.55771 WP_011331930.1.58385 WP_011331930.1.58965 WP_011331930.1.62013 WP_011331930.1.64081 WP_011331930.1.6588 WP_011331930.1.72974 WP_011331930.1.75567 WP_011331930.1.84829 WP_011331930.1.91175 WP_011331930.1.91687 WP_011331930.1.91867 WP_011331930.1.96080 WP_011331930.1.98588 WP_011331930.1.9994 gi|77456451|ref|YP_345956.1| 205922.Pfl01_0223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]