SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77457259|ref|YP_346764.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77457259|ref|YP_346764.1|
Domain Number 1 Region: 25-278
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000712
Family Phosphate binding protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77457259|ref|YP_346764.1|
Sequence length 297
Comment hypothetical protein Pfl01_1032 [Pseudomonas fluorescens Pf0-1]
Sequence
MPSASNRAHHWWTWRLFGLLFLLVLPTWAQAKPTLIWLLRDLPPLTIFEGPKKGQGVIDQ
LMPMLIAGMPQYEHTLMRVNRARGTQMLHEHPFACDPSLIWNKERAQWIAFSIPAFRAVS
NGLVVRQRDREVLEPFLVEGEVDLSAFLANGERKVGVVAERSYGEYIDTLLHQAPSGALT
PHYGNDALISLLSMQRLGRLQVVLGYWPEIRYQARQAKIAEDELLFFPIRGTGKYLSGHV
GCTDTTAGRQAITEINQLLRTLPHEHLNQLYADWLDPERRQDYLEQARIFFQQQAAQ
Download sequence
Identical sequences Q3KHI1
205922.Pfl01_1032 gi|77457259|ref|YP_346764.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]