SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77458291|ref|YP_347796.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77458291|ref|YP_347796.1|
Domain Number 1 Region: 1-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-71
Family Phosphate binding protein-like 0.000000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77458291|ref|YP_347796.1|
Sequence length 259
Comment lysine-arginine-ornithine-binding periplasmic protein [Pseudomonas fluorescens Pf0-1]
Sequence
MKKLVMFGALALSMLSLTAVAEDAKPIRIGIEAGYPPFSMKTPDGKLAGFDVDIGDALCE
QMKVKCTWVEQEFDGLIPALKVKKIDAILSSMTITDDRKKNVDFTIKYYHTPARFVMKAG
SGVKDPLTELKGKKVGVLRASTHDRYATEVLVPAGIELVRYGSQQEANLDMVSGRIDAML
ADSVNLSDGFLKTDAGKGFEFVGPTYEDAKYFGGGAGIAVRKGDTELAEKFNTAINEIRA
NGKYKQVQDKYFDFDVYGH
Download sequence
Identical sequences A0A2A5R213 Q3KEJ9
WP_011333505.1.1491 WP_011333505.1.2668 WP_011333505.1.31280 WP_011333505.1.39127 WP_011333505.1.46342 WP_011333505.1.55686 WP_011333505.1.66386 WP_011333505.1.77688 205922.Pfl01_2064 gi|77458291|ref|YP_347796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]