SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77458382|ref|YP_347887.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77458382|ref|YP_347887.1|
Domain Number 1 Region: 27-364
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.76e-83
Family Phosphate binding protein-like 0.00000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77458382|ref|YP_347887.1|
Sequence length 365
Comment spermidine/putrescine transport system substrate-binding protein [Pseudomonas fluorescens Pf0-1]
Sequence
MGLHNLSKALLLVLAPLCVQAAETAKPVVNLYIWGEYLAPDTLKNFEAKTGIRVVADHFD
SLETVETKLLTGRSGYDLVLTAGQHLSRAIESGAIQTLNKQQLPHFAGVGDEFRQHMAVF
DPGNRYAGIYAWGTTGVGYQEEAVKQRLPDAPRDSWAMLFDPAVVSKFADCGVSLLNDPN
EVFAAVMKYMGLDINRQSLDDLKLAEQQLAKIRPYIRYFDNDLNISDLANGNICVAMSWN
GNVAIAAGQAEAARKPFKLNYRIPKEGTLIWFDAMVIPKDAPHPEAGLALMDYLMTPEVI
APITDTIHYANAITAADGLVDPAIRNDPGTYPPEAVKASLYSKNDNGKAFNRALIRAFSR
LKSGL
Download sequence
Identical sequences Q3KEA8
gi|77458382|ref|YP_347887.1| WP_011333588.1.2668 205922.Pfl01_2155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]