SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77458902|ref|YP_348408.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77458902|ref|YP_348408.1|
Domain Number 1 Region: 22-360
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.07e-96
Family Phosphate binding protein-like 0.00000000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77458902|ref|YP_348408.1|
Sequence length 361
Comment extracellular solute-binding protein [Pseudomonas fluorescens Pf0-1]
Sequence
MIRKTLALAPLMLAVSFAQAADTVKVYNWSDYIAPDTAKNFEKASGIGVTYDVYDSNETL
DGKLMTGKSGYDVVFPSNHFMARQIEGGALKKLDKSQLPNWKNLNPVLLKALQTNDPGNE
HGFPYLWGSTGIGYNVAKVKAVLGDNAPVDSWDLIFKPEYMEKLQKCGVAILDNGPELLP
AALNYLGLPHHSKNPEDYKKAEALLMKVRPYVSYFHSSKYTSDLANGDICVAVGFSGDIL
QAENRAKEAKNGIDIGYEIPKEGAAIWFDMVAMPADAPDEKAGYAFMNYLLQPDVMAGIS
NYVHYANGNEQADSLIDPAIKNDTKVYPSPEMMGKLFALEAMPLNIDRIRTRVWNKIRTG
S
Download sequence
Identical sequences Q3KCT7
WP_011334090.1.2668 205922.Pfl01_2677 gi|77458902|ref|YP_348408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]