SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77459314|ref|YP_348821.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77459314|ref|YP_348821.1|
Domain Number 1 Region: 13-269
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.21e-55
Family Phosphate binding protein-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77459314|ref|YP_348821.1|
Sequence length 282
Comment extracellular solute-binding protein [Pseudomonas fluorescens Pf0-1]
Sequence
MHRRPSLFKACVFVLAASSAVMGIAQAADSKLDSVLARGKLIVGTGSTNAPWHFQGADGK
LQGFDIDIARMVAKGLFNDPSKVEFVVQSSDARIPNLLTDKVDMSCQFITVTASRAQQVA
FTLPYYREGVGLLLPNNSKYKEIEDLQAGGDGVTVAVLQNVYAEELVHQALPKAKVDQYD
SVDLMYQAVNSGRADAAATDQSSVKYLMVQNPGRYRSPTYAWSPQTYACAVKRGDQDWLN
FVNTALHEAMTGVEFPTYAASFKQWFGVDLPSPAIGFPVEFK
Download sequence
Identical sequences Q3KBM4
205922.Pfl01_3092 WP_011334482.1.2668 gi|77459314|ref|YP_348821.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]