SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77459570|ref|YP_349077.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77459570|ref|YP_349077.1|
Domain Number 1 Region: 8-181
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.73e-27
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77459570|ref|YP_349077.1|
Sequence length 183
Comment cytochrome B561 [Pseudomonas fluorescens Pf0-1]
Sequence
MTRDMAAPRYGKLSITLHWLMLALFVGVYACVEIKGFMPRGSEARGLLMGLHGMFGASIF
VLVWVRLFGRLTPRPPITPKPPAWQTAIAHLMHLALYGLMIVTPVLAWLMLAAGDKPFPY
FGFHVPAPVAVDPDLAKQIKHWHELIGNAGYWLIGLHAAAGLFHHYWVGDDTLDRMLGGR
TRS
Download sequence
Identical sequences Q3KAW8
205922.Pfl01_3348 WP_011334720.1.2668 gi|77459570|ref|YP_349077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]