SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77460756|ref|YP_350263.1| from Pseudomonas fluorescens Pf0-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77460756|ref|YP_350263.1|
Domain Number 1 Region: 10-272
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.38e-65
Family Phosphate binding protein-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77460756|ref|YP_350263.1|
Sequence length 304
Comment extracellular solute-binding protein [Pseudomonas fluorescens Pf0-1]
Sequence
MRIVPHILGAAIAAALISTPVFAAELTGTLKKIKESGVITLGHRDASIPFSYIADASGKP
VGYSHDIQLAIVEAIKKDLDLPNLQVKYNLVTSQTRIPLVQNGTVDVECGSTTNNVERQQ
QVDFSVGIFEIGTRLLSKADSKYKDFDDLKGKNVVTTAGTTSERILKAMNADKQMGMNVI
SAKDHGESFQMLESGRAVAFMMDDALLAGEAAKAKKASDWAVTGTPQSYEIYGCMMRKGD
EPFKKAVDDAIKATYASGEINKIYEKWFMQPIPPKGLNLNFPMSDELKALIANPTDKAAD
DKKS
Download sequence
Identical sequences A0A173J757 Q3K7I2
gi|77460756|ref|YP_350263.1| WP_011335750.1.15864 WP_011335750.1.2668 WP_011335750.1.38776 WP_011335750.1.53106 WP_011335750.1.54700 WP_011335750.1.55771 WP_011335750.1.58965 WP_011335750.1.96080 WP_011335750.1.98588 205922.Pfl01_4535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]