SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|104780860|ref|YP_607358.1| from Pseudomonas entomophila L48

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|104780860|ref|YP_607358.1|
Domain Number 1 Region: 3-365
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.16e-114
Family FMN-linked oxidoreductases 0.00000000207
Further Details:      
 
Domain Number 2 Region: 336-524
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.94e-43
Family N-terminal domain of adrenodoxin reductase-like 0.00000801
Further Details:      
 
Domain Number 3 Region: 465-523,561-656
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.18e-21
Family C-terminal domain of adrenodoxin reductase-like 0.0000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|104780860|ref|YP_607358.1|
Sequence length 678
Comment 2,4-dienoyl-CoA reductase [Pseudomonas entomophila L48]
Sequence
MANARYPHLLAPLDLGFTTLRNRTLMGSMHTGLEERPGGFERMAAYFAERARGGVGLMVT
GGIAPNDEGGVYSGAAKLSTEEESDKHRIVTEAVHAAGGKICLQILHAGRYAYSPKQVAP
SAIQAPINPFKPKELDEEGIEKQIRDFVTCASLAQRAGYDGVEIMGSEGYFINQFLAAHT
NHRTDRWGGSYENRMRLAVEIVRRVREAVGPNFIIIFRLSMLDLVEGGSTWDEIVVLAKA
IEQAGATLINTGIGWHEARIPTIATKVPRAAFSKVTAKLRGAVKIPLITTNRINTPEVAE
AVLAEGDADMVSMARPFLADPDFVNKAAEGRADEINTCIGCNQACLDHTFGGKLTSCLVN
PRACHETELNYVPVRAVKRIAVVGAGPAGLAAATVAAERGHEVTLFDAGSEIGGQFNVAK
RVPGKEEFFETLRYFRNKVKSTGVDLRLNTRVDVAALVAGEYDEIILATGIAPRTPAIPG
IDNAKVLSYLDVLLERKPVGERVAVIGAGGIGFDVSEYLVHKGVATSQDREAFWKEWGID
TQLEARGGVAGIKPEPHAPARQVYLLQRKKSKVGDGLGKTTGWIHRTGLKNKHVQMLNSV
EYLSVDDAGLHVRINEGEPQLLAVDNIVVCAGQEPLRELQEGLVAAGQSVHLIGGADVAA
ELDAKRAINQGSRLAAEL
Download sequence
Identical sequences Q1ICR1
gi|104780860|ref|YP_607358.1| WP_011532962.1.45913 384676.PSEEN1703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]